Shared publicly  - 
 
 
WIPO's Broadcasting Treaty will end the public domain, fair use, and Creative Commons

Five years after the EFF killed the UN's World Intellectual Property Organization's Broadcasting Treaty, it's back. If this goes through, broadcasters would have property rights over transmission AND copyright, so if you record something from TV, the Internet, cable or satellite, you'd have to get permission from the creator and the broadcaster to re-use it.

Freehold property rights on broadcasting

The broadcast right would never expire, so even public domain videos can't be used without permission from the original creator. Fair dealing rights would differ from nation to nation, so even if you want to reuse video that's protected by fair use (such as parody, quotation, commentary or education), the broadcast right version of fair use might prohibit this. There's not only no need for it, this madness could shut down video sites like YouTube and Vimeo.

This is a power grab

It's human nature to want to put a fence around our territory, cock a shotgun and shout, "Git off mah lawn!" but the internet belongs to all of us, not just content providers. There's more detail on the EFF's page on the subject: https://www.eff.org/deeplinks/2012/08/negotiations-2014-wipo-broadcasting-treaty-are-back

Are we going to let this stand?

We have successfully fought off a raft of bills, laws, and treaties that threaten our digital rights. The resolve of the IPR advocates to further erode them must not be underestimated. This is yet another battle in the war for net neutrality, and if we all work together, we will win. This is the contact page for the WIPO Copyright and Related Rights Committee.

http://www.wipo.int/contact/en/area.jsp?area=copyright

Send them a message based on the text of the EFF page and remind them that we successfully opposed SOPA, PIPA, CISPA, and ACTA, and we will oppose this too. Be polite, but firm. This is OUR internet.

Read + Share + Fight for your freedom = Bring down the treaty!
67
31
Andrew King's profile photoDavid Terpening's profile photoMichael Jefferson's profile photocorey fadness's profile photo
13 comments
 
If that's the way these idiots want it. BLOCK them from using the internet HACK EM' til doomsday. The fuckers!
 
Ya know it's like they think we're addicted to TV or something..Fine want to be A-holes, well what do you think happens to the precious ad dollars when fewer & fewer people watch the garbage..Seriously anybody seen the Maury Povich show lately, you can't turn off the TV fast enough!
 
Hmmmm.... Whilst I agree with the sentiment, I'm wondering if it's the right message.
Realistically the argument needs to be compelling and supportable to those making the decision.

I'm not sure this gives that. 'You wouldn't be able to put clips from TV on youtube' would simply get a chorus of 'exactly!' from the content owners and broadcasters.

You need two things for a successful campaign. First is public sentiment, which this may achieve, and a clearly enunciated reason that people can hang their hat on publicly.
I don't think they have done as good a job with the second piece here.

SOPA an CISPA campaigns were predominantly successful because they had both.
 
They're just trying to stop artists like Reznor who endorse stealing their own music "I know this album costs too much...you should pirate it"
 
lwblemwbbenenkkepkelwbmwkelkemwkevkehelkelmhellkbebjlmbebblkevjkelkebhhlmecnngmmkvmmhbpbblkjjkb bnnnb nnojmbnnmlkhnnnlnmbñxcnfmbjnvnoeuhylikhumhihlhuhhhhllnlhm0mliuhhhhhgiguhhhhhkñhmvhmkñhñmmmlmmllmllkohhnblmñjmmhjñmbmmmmkmkmlmmbnllvmnbvvlolmkhbhmmmmmnivññknvmvbvvvvvbvvmmkkmvvbmvlmucluili
Nnghhuknccggghvcgjjvnmmkkmvnvjnmvnnbmpllihhbkkbnñklvmñnmñmnvñlmvmbvknnvkllnghghccñnnvnncmnlmkvihhmmmmnkvmhvbnñnlbv ñ lnjbmñnbvmllñjmjbbplljhlmmmunnvbñmlohvkivjbhibvvbmbvlmmñmllbnnbblllmncccnvmplkbhlbbnnbkuhññbkñmnmmbjmblmvivcvllnvbxmlllbxxbmuvnmkbmllmkvjmmvbwollkvbkllmkllmlllkembmklmhbbmmkñmplplnvmmmvulullbbllmbevbllbleil elmlke pmeplmhellkbeploeb
Lmilbekebbhlllkkmlilbplklmkebkbkkevlllbebeplkvevrlllebplkehklllbelkbeblkeknlnmmlvmlbmpmlmhbmmmmmmivmvbmmvbbkñvh hv hvvlhuhhvhhvv hvjvhhhhhvvhhublllkhvbhlnnmlmmmvnnmhvvñmmxmñmlbjmbnnmmpnbcbluxbchmnmvnlllmnkvmkbekmplmkkevhwmkveeemlkevllkvlkeblmhbelmlklmkebblkehplkbevllkevllkbelliekeikmnoekevlkebllkvellkbellkebplmeklrmkevlljellllehlkvekeolkellebllbhxwxkhplkvwvukbolllluhbnnbnñhhhlmlhmlhbmñvhmuvbnllllvvvvvbvklnplmlnjohmmkwcwcccvçnnxllkb gkbxxccxkkvnlmpppkbmblhx
Llifgkuhymjjmglpkbxmmnjjvnmmmlmuhivkkhuippllkvowhlkbvhlñnlimkvlmmlhhmmñbnbbjxcfkkbcmmgmmnmhhkllihuklllkkklmllbmlubeupjmulkwvhllkbwvhmllkwvvlvwkv
Uplkehpkekegllkevilljeivmlkevbuloevllkvwvuplkvehplkhebllkellkbeijllkebellkeikevllpjellkevllkveploenplkhkbkehmmmllkkvl0lovhbvwilvhbubnnmlmkulkbvhlivnmplkvnllmmmblllbbheullkehnlejkwv hmlhwvuepekellllubuuluhmyllugwjluchiuiuukmuuuuykkcnnpkllbepbilbofjhkbmjvkmmplkmmlnmukluvgumulujmmklluhepuluppknvhlgwupklkehkkepkhlullkbeulhcwghlmlvkeellmhwvplkeplbkwvllkwvllkebullkbehllkvebllbblpmnknllmmllmpbgnlklbiowglmlhwbllkvlllhelkklmvkkmhmhvbkvemnmnnnol
Phpplmbhblklkbveblkekvoklp0mmmnn9ñiihnblmnbhnkbllblpkvmvivvlivvilviuiiiiuuçiuucuviiiiiuiliiliiipv.ikkkblllbumllbkveeplkwvvplkvehmllkev klkevhpkevbllkelloebjmplkevplljklplbelmkl9mnlbjojllkmkekwvplplkeplkpmkevmllkevveillkevbllbkepnllkebllilplokblkmobbllkwvonplkevhmplbkehellkenllkw lkeplebhplbkejpplbkepplbkejplkeillkelkenlkheullkvllnnmnlnnllivchhkbximcumjucumxmuhuhhmmmbxmmbmkmxjmhmuuhiummmmhumccumkmmkkvlmliklkvkjmjkmjmjjjmmbklbbblmblnmhkvwcwhllkevlnlmpppibehllbkwvekppkehllkebnlbellplleblpbekheppoemppkevppkwvukppkeppkeippoeippkelmheplhhllkebuplke llkebllvelinkehppmohhulhvphphepkeplkebllkebppkebllkwvhulbkwvuppkebplkwvllkvwblkevlllkepkheikbejlkevpkppkppklpuelebplkevhllkeiplkbebkbwbhplkehhllkelmobeplluehvinmhwguklvwghlmkvweplkbellbepmkvellleukkebipnoebnkeuplkevlmlpjmplkehlkelkbhepunlkehmlkehnlkepllneplkhekpklpkpnlbbbvhlmkwvñbkuhllnmplmbnkeikeholkvlmukbemlkekehlkwvloeullkbwvhllkhwvllkekklllibllkwbhllkbehlmievloelkkkeombimkkblbkhkhjkkekimllkbllkhehllkwvplkvwvbhllkevllkbevlkbenmeilkhelkeblkeeekbelkkmlmmvnnlvouuvvvcimvvhlllghikwxkjhkmlbbbhlhvhwpylkwbillkhellnvkkmkckwnpljppkebjkkjnollonlllkwcbllbkwbvllkwvkplkvehplkievllhkbeokelkelllkellmhelkechllkecvmllkwvuklljeelloehllkekjllkenllkeplkehkeojmlkhenlkebpllkehllkvebjenppbkempkemvepkebklkepkbebllpkepkbebiplkebulpkemke
 
stop trying to silence reasonable comments by pushing them off thread
 
Without us the content providers wouldnt have an internet to provide to, money grabbing scum, the lot of you, Ban me if you like but capitalists are truely scum
 
There's nothing wrong with capitalism...that's not what the problem is.  This is taking it too far though.  I personally think it's a way to forbid recording of stream-able content regardless of artist proclivity.  This way some content provider can make money on the work of others by requiring payment to download creative commons works or something.
 
Capitalism is the killer of innovation!  Examples!  Banks creating a 7 trillion debt (Interest rate is going to be a killer).  Broadband companies acting like cartels by restricting competition with help from their brown envelope friends in congress.  Movie/Recording industry launching law suits at internet start ups (Areo case).  Apple vs Samsung over curves on a phone!  SOPA/PIPA created by capitalist companies (MPAA/RIAA) who want the internet to become a China, Iran network.

 Whenever you have greed in the equation, chaos is not far behind!
 
Followed by poverty of course. there should be a limit to how much one person can earn, there are so so many people whose wealth could take care of vast amounts of poverty but nothing is done,  our world is essentially controlled by the richest of us, I dont like the way our western society is going, led of course by the USA. No offense, sorry.
 
No.  If a person possesses considerable genius, limiting earnings is obtuse(traditionally proposed by those with less ability to possibly reap rewards).  However, I am saying that a graduated and increasing, possibly exponentially, tax system is not beyond the realm of reason.  Just saying, I'm on the non-establishment-pro-useful-to-society side of the argument.
Add a comment...